CAV1 Antibody

SKU: orb11600

Description

Goat polyclonal to Caveolin-1 – caveolae marker. This scaffolding protein is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression.

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IF:1:25-1:250, IHC-P:1:200-1:1,000, IHC-F:1:200-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli. Antigen Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTH
• Target: Caveolin-1
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CAV1, caveolin, caveolae protein 1, cell growth-inhibiting protein 32 antibody.

Western blot analysis of MDCK cell lysate using Caveolin-1 antibody

Confocal immunofluorescence analysis of Hepa1-6 cells using Caveolin-1 antibody

Quick Database Links

Gene Symbol

Caveolin-1