beta-Actin Antibody

SKU: orb420055

Description

Actin proteins are highly conserved and ubiquitously expressed in all eukaryotic cells. These proteins are the major components of the cytoskeleton and involved in various types of cell motility.

Research Area

Cancer Biology; Musculoskeletal & Connective Tissue Research

Images & Validation

• Tested Applications: IF, IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:250-1:2,000, IF:1:50-1:250, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. Antigen Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE
• Target: beta-Actin
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ACTB, beta-actin, BRWS1, PS1TP5BP1 antibody.

Quick Database Links

Gene Symbol

beta-Actin