BCL2 Antibody

SKU: orb1463330

Description

Goat polyclonal antibody to BCL2. This protein belongs to a family that act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Regulates cell death by controlling the mitochondrial membrane permeability and appears to function in a feedback loop system with caspases.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:2,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant affinity purified peptide derived from within residues 143 aa to the N-terminus of human BCL2 produced in E. coli. Antigen Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVN
• Target: BCL2
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Apoptosis Regulator Bcl-2, BCL2 Apoptosis Regulator, B-Cell CLL/Lymphoma 2, PPP1R50, Protein Phosphatase 1 Regulatory Subunit 50 antibody.

Quick Database Links

Gene Symbol

BCL2