You have no items in your shopping cart.
Cart summary
Item 1 of 1
APOBEC3C Rabbit Polyclonal Antibody
Catalog Number: orb589337
| Catalog Number | orb589337 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to APOBEC3C |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human APOBEC3C |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 23 kDa |
| Target | APOBEC3C |
| UniProt ID | Q9NRW3 |
| Protein Sequence | Synthetic peptide located within the following region: EGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLK |
| NCBI | NP_055323.2 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | A3C, PBI, ARP5, ARDC2, ARDC4, APOBEC1L, bK150C2.3 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human HepG2 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
- Item 1 of 2
APOBEC3C Rabbit Polyclonal Antibody [orb155695]
ICC, IF, IHC-Fr, IHC-P
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
