You have no items in your shopping cart.
Description
Research Area
Neuroscience
Images & Validation
−
Key Properties
−| Source | Protein expressed in Escherichia coli. |
|---|---|
| MW | 14490Da |
| Purity | 95% by Chromatography and SDS-PAGE |
| Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTT VAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQ EGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Storage & Handling
−| Storage | Room temperature, avoid light exposure. |
|---|---|
| Form/Appearance | Lyophilized 1 mg/vial |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−- Item 1 of 8
Alpha Synuclein A53T Mutant Pre-formed Fibrils [orb1822360]
In vitro, In vivo, SDS-PAGE, WB
>95%
~14.46 kDa
Recombinant
100 μg - Item 1 of 2
Alpha Synuclein A53T Mutant Monomers [orb1822355]
In vitro, In vivo, SDS-PAGE, WB
>95%
~14.46 kDa
Recombinant
100 μg Human SNCA A53T Protein [orb428503]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mgHuman SNCA A30P/A53T Protein [orb169309]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days