Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

AKT1 Rabbit Polyclonal Antibody

SKU: orb592717

Description

AKT1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of AKT1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human AKT1. This antibody reacts with Frog, Human, Primate samples and is predicted to react with Bovine, Canine, Goat, Mouse, Porcine, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityFrog, Human, Primate
Predicted ReactivityBovine, Canine, Goat, Mouse, Porcine, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AKT1
TargetAKT1
Protein SequenceSynthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AKT, PKB, RAC, PRKBA, PKB-ALPHA, RAC-ALPHA

Similar Products

  • Phospho-AKT (Ser473) Rabbit Polyclonal Antibody [orb11293]

    WB

    Bovine, Canine, Gallus, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • AKT1+2+3 Rabbit Polyclonal Antibody [orb155629]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AKT1 + AKT2 + AKT3 (Thr308+Thr309+Thr305) Rabbit Polyclonal Antibody [orb6780]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-Akt (Thr308) Rabbit Polyclonal Antibody [orb14786]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AKT1+AKT2+AKT3 (Tyr315+316+312) Rabbit Polyclonal Antibody [orb6789]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

AKT1 Rabbit Polyclonal Antibody

Lanes: 1. 50 ug xenopus laevis embryos lysate (lysate buffer), 2. 50 ug xenopus laevis embryos lysate (HB buffer), Primary Antibody Dilution: 1:500, Secondary Antibody: Goat Anti-Rabbit AP, Secondary Antibody Dilution: 1:20000, Gene Name: AKT1.

AKT1 Rabbit Polyclonal Antibody

Rabbit Anti-AKT1 Antibody, Catalog Number: orb592717, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm, Plasma membrane, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

AKT1 Rabbit Polyclonal Antibody

WB Suggested Anti-AKT1 Antibody, Positive Control: Lane 1: 50 ug preterm baboon muscle homogenate, Lane 2: 50 ug preterm baboon muscle homogenate, Lane 3: 50 ug term baboon muscle homogenate, Lane 4: 50 ug term baboon muscle homogenate, Lane 5: 50 ug adult baboon muscle homogenate, Lane 6: 50 ug adult baboon muscle homogenate, Primary Antibody Dilution: 1:1666, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:1200.

AKT1 Rabbit Polyclonal Antibody

WB Suggested Anti-AKT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005154

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

AKT1 Rabbit Polyclonal Antibody (orb592717)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry