ADORA2A Antibody

SKU: orb653860

Description

Goat polyclonal antibody to ADORA2A. It is a member of the guanine nucleotide binding coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular stimuli and activate intracellular signal transduction pathways. It plays an important role in many biological functions, including cerebral and renal blood flow, immune function, cardiac rhythm and circulation, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as neurodegenerative and inflammatory disorders.

Images & Validation

• Tested Applications: IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 360 aa to the C-terminus of human ADORA2A produced in E. coli. Antigen Sequence: YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
• Target: Adenosine receptor A2a
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

A2aR, ADORA2, RDC8 antibody.

Quick Database Links

Gene Symbol

Adenosine receptor A2a