You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580095 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZSCAN12 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Porcine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZSCAN12 |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 66kDa |
Target | ZSCAN12 |
UniProt ID | O43309 |
Protein Sequence | Synthetic peptide located within the following region: QEMFLQETVRLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNE |
NCBI | NP_001034732 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZSCAN12 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |