You have no items in your shopping cart.
Cart summary
Item 1 of 1
ZSCAN12 Rabbit Polyclonal Antibody
Catalog Number: orb574788
| Catalog Number | orb574788 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZSCAN12 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZSCAN12 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 66kDa |
| Target | ZSCAN12 |
| UniProt ID | A8K187 |
| Protein Sequence | Synthetic peptide located within the following region: RLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVS |
| NCBI | NP_001034732 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | ZFP96, ZNF96, ZNF305, ZNF29K1, dJ29K1.2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-ZSCAN12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.
- Item 1 of 1
- Item 1 of 1
ZSCAN12 Rabbit Polyclonal Antibody [orb580095]
WB
Bovine, Porcine
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
- Item 1 of 1
