Zscan12 Rabbit Polyclonal Antibody

• Catalog Number: orb577451
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Zscan12
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Mouse
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: Zscan12
• UniProt ID: Q9Z1D7
• Protein Sequence: Synthetic peptide located within the following region: WEGTEAEQNPASRLAKDALECEEAHNPGEESSGISHEDSQPLRNENGVNS
• NCBI: NP_057893
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Zfp9, Zfp96, FPM315, zfp-96, mKIAA0426, 2510038J07
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Zscan12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: NIH/3T3 cell lysate.