ZNF180 Rabbit Polyclonal Antibody

• Catalog Number: orb575668
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF180
• Target: ZNF180
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF180
• Protein Sequence: Synthetic peptide located within the following region: LHIHEKIHGGGKTFDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHS
• UniProt ID: Q9UJW8
• MW: 79kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HHZ168
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_037388

Rabbit Anti-ZNF180 antibody, Catalog Number: orb575668, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ZNF180 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. ZNF180 is supported by BioGPS gene expression data to be expressed in HEK293T.