Cart summary

You have no items in your shopping cart.

NSEP1 Rabbit Polyclonal Antibody

SKU: orb324533

Description

Rabbit polyclonal antibody to YBX1

Research Area

Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NSEP1
TargetYBX1
Protein SequenceSynthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF
Molecular Weight36kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-BP 8 antibody, anti-CBF-A antibody, anti-CCAAT binding transcription factor I subunit A antibody, anti-CCAAT-binding transcription factor I subunit A antibody, anti-CSDA2 antibody, anti-CSDB antibody, anti-DBPB antibody, anti-DNA binding protein B antibody, anti-DNA-binding protein B antibody, anti-EFI-A antibody, anti-Enhancer factor I subunit A antibody, anti-NSEP1 antibody, anti-Nuclease sensitive element binding protein 1 antibody, anti-Nuclease-sensitive element-binding protein 1 antibody, anti-p50 antibody, anti-Q15905 antibody, anti-Y-box binding protein 1 antibody, anti-Y-box transcription factor antibody, anti-Y-box-binding protein 1 antibody, anti-YB 1. YB-1 antibody, anti-YBOX1_HUMAN antibody, anti-YBX 1 antibody, anti-YBX1. antibody

Similar Products

  • Phospho-YB1 (Ser102) Rabbit Polyclonal Antibody [orb5632]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine

    Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • YB1/YBX1 Rabbit Polyclonal Antibody [orb259642]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • YB1/YBX1 Rabbit Polyclonal Antibody [orb76271]

    FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • YB1 Rabbit Polyclonal Antibody [orb100303]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • YBX1 (Phospho-S102) Rabbit Polyclonal Antibody [orb318915]

    IHC,  WB

    Bovine, Gallus, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 30 μl, 100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NSEP1 Rabbit Polyclonal Antibody

WB Suggested Anti-NSEP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, YBX1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004550

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NSEP1 Rabbit Polyclonal Antibody (orb324533)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry