Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NSEP1 Rabbit Polyclonal Antibody

SKU: orb324533

Description

NSEP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of YBX1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human NSEP1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NSEP1
TargetYBX1
Protein SequenceSynthetic peptide located within the following region: NMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNF
Molecular Weight36kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-BP 8 antibody, anti-CBF-A antibody, anti-CCAAT binding transcription factor I subunit A antibody, anti-CCAAT-binding transcription factor I subunit A antibody, anti-CSDA2 antibody, anti-CSDB antibody, anti-DBPB antibody, anti-DNA binding protein B antibody, anti-DNA-binding protein B antibody, anti-EFI-A antibody, anti-Enhancer factor I subunit A antibody, anti-NSEP1 antibody, anti-Nuclease sensitive element binding protein 1 antibody, anti-Nuclease-sensitive element-binding protein 1 antibody, anti-p50 antibody, anti-Q15905 antibody, anti-Y-box binding protein 1 antibody, anti-Y-box transcription factor antibody, anti-Y-box-binding protein 1 antibody, anti-YB 1. YB-1 antibody, anti-YBOX1_HUMAN antibody, anti-YBX 1 antibody, anti-YBX1. antibody

Similar Products

  • Phospho-YB1 (Ser102) Rabbit Polyclonal Antibody [orb5632]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Guinea pig, Porcine

    Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • YB1/YBX1 Rabbit Polyclonal Antibody [orb259642]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • YB1/YBX1 Rabbit Polyclonal Antibody [orb76271]

    FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • YB1 Rabbit Polyclonal Antibody [orb100303]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • YBX1 Antibody (C-term) [orb1930107]

    IF,  WB

    Mouse, Other, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_004550

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry