XPOT Rabbit Polyclonal Antibody

SKU: orb577742

Description

Rabbit polyclonal antibody to XPOT

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC-P, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XPOT
• Target: XPOT
• Protein Sequence: Synthetic peptide located within the following region: TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL
• Molecular Weight: 110kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

XPO3

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 57 kDa isoform.

Rabbit Anti-XPOT Antibody, Catalog Number: orb577742, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic and nuclear, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-XPOT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. XPOT is supported by BioGPS gene expression data to be expressed in Jurkat.

XPOT was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb577742 with 1:200 dilution. Western blot was performed using orb577742 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: XPOT IP with orb577742 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

Quick Database Links

Gene Symbol

XPOT

UniProt

O43592

RefSeq (Protein):NP_009166