You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC-P, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human XPOT |
| Target | XPOT |
| Protein Sequence | Synthetic peptide located within the following region: TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL |
| Molecular Weight | 110kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Exportin T Rabbit Polyclonal Antibody [orb183469]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlXPOT Rabbit Polyclonal Antibody [orb633040]
ELISA, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgExportin T Rabbit Polyclonal Antibody (HRP) [orb477694]
IHC-Fr, IHC-P
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
Human
Rabbit
Polyclonal
HRP
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 57 kDa isoform.

Rabbit Anti-XPOT Antibody, Catalog Number: orb577742, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic and nuclear, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-XPOT Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate. XPOT is supported by BioGPS gene expression data to be expressed in Jurkat.

XPOT was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb577742 with 1:200 dilution. Western blot was performed using orb577742 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: XPOT IP with orb577742 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.
Documents Download
Request a Document
Protocol Information
XPOT Rabbit Polyclonal Antibody (orb577742)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






