You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576732 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to XBP1 |
Target | XBP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human XBP1 |
Protein Sequence | Synthetic peptide located within the following region: LMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTA |
UniProt ID | P17861 |
MW | 29kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | XBP2, TREB5, XBP-1, TREB-5 |
Note | For research use only |
NCBI | NP_005071 |
Rabbit Anti-XBP1 Antibody, Catalog Number: orb576732, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, WB | |
Bovine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit, Rat | |
Canine, Human | |
Rabbit | |
Polyclonal | |
Unconjugated |