You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573800 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to XBP1 |
Target | XBP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human XBP1 |
Protein Sequence | Synthetic peptide located within the following region: TQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN |
UniProt ID | P17861 |
MW | 29 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | XBP2, TREB5, XBP-1, TREB-5 |
Note | For research use only |
NCBI | NP_005071 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 34 kDa.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. XBP1 is supported by BioGPS gene expression data to be expressed in MCF7.
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 0.5 ug/ml.
WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
FC, ICC, WB | |
Bovine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Mouse, Porcine, Rabbit, Rat | |
Canine, Human | |
Rabbit | |
Polyclonal | |
Unconjugated |