XBP1 Rabbit Polyclonal Antibody

• Catalog Number: orb576733
• Category: Antibodies
• Description: Rabbit polyclonal antibody to XBP1
• Target: XBP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Canine, Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human XBP1
• Protein Sequence: Synthetic peptide located within the following region: LISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWG
• UniProt ID: P17861
• MW: 29kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: XBP2, TREB5, XBP-1, TREB-5
• Note: For research use only
• NCBI: NP_005071

Lanes: Lane 1: 40 ug whole canine retina, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: XBP1 a.

WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.