WNT1 Rabbit Polyclonal Antibody

• Catalog Number: orb574055
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WNT1
• Target: WNT1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WNT1
• Protein Sequence: Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV
• UniProt ID: P04628
• MW: 38kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: INT1, OI15, BMND16
• Note: For research use only
• NCBI: NP_005421

Sample Type: 1. Molecular Weight, 2. Control (20 ug), 3. shRNA1-WNT1 H9 hES cells (20 ug), 4. shRNA2-WNT1 H9 hES cells (20 ug), Primary dilution: 1:1000, Secondary Antibody: anti-Rabbit HRP, Secondary dilution: 1:5000.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Tissue: Human HepG2, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-WNT1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Muscle.