You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Virus PS/HR protein
Catalog Number: orb595050
| Catalog Number | orb595050 |
|---|---|
| Category | Proteins |
| Description | Recombinant Vaccinia virus Protein B5(PS/HR),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 33.0 kDa |
| UniProt ID | P21115 |
| Protein Sequence | YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH |
| Protein Length | Partial |
| Source | Baculovirus |
| Biological Origin | Vaccinia virus (strain Copenhagen) (VACV) |
| Expression Region | 18-279aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Plaque-size/host range protein Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) PS/HR.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) PS/HR.
- Item 1 of 3
Virus PS/HR protein [orb595055]
Greater than 85% as determined by SDS-PAGE.
52.6 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 2
Virus PS/HR protein [orb605412]
Greater than 85% as determined by SDS-PAGE.
31.1 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Vaccinia virus Protein B5 (PS/HR), partial [orb2659816]
Greater than 95% as determined by SDS-PAGE.
30.6 kDa
Yeast
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Vaccinia virus Protein B5 (PS/HR), partial [orb1881797]
Greater than 90% as determined by SDS-PAGE.
38.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Virus PS/HR protein [orb595190]
Greater than 90% as determined by SDS-PAGE.
33.2 kDa
in vitro E.coli expression system
20 μg, 100 μg
