You have no items in your shopping cart.
Cart summary
Item 1 of 1
Virus A27L protein
Catalog Number: orb605439
| Catalog Number | orb605439 |
|---|---|
| Category | Proteins |
| Description | Recombinant Variola virus 14 kDa fusion protein(A27L) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Protein Length | Full Length |
| UniProt ID | P33816 |
| MW | 14.5 kDa |
| Application notes | Full Length |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus) |
| Expression Region | 1-110aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | A27L, A30L14 kDa fusion protein |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Virus A27L protein [orb605429]
Greater than 90% as determined by SDS-PAGE.
28.6 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 2
Virus A27L protein [orb595052]
Greater than 85% as determined by SDS-PAGE.
16.6 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 1
Virus A27L protein [orb604609]
Greater than 85% as determined by SDS-PAGE.
19.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Vaccinia virus 14 kDa fusion protein (A27L) [orb1785185]
Greater than 85% as determined by SDS-PAGE.
19.9 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Cowpox virus 14 kDa protein (A27L) [orb1881874]
Greater than 95% as determined by SDS-PAGE.
14.4 kDa
Mammalian cell
1 mg, 20 μg, 100 μg
