You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb595052 |
---|---|
Category | Proteins |
Description | Recombinant Vaccinia virus 14 kDa fusion protein(A27L) |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
Protein Length | Full Length |
UniProt ID | P20535 |
MW | 16.6 kDa |
Application notes | Full Length |
Endotoxins | Not test. |
Source | Baculovirus |
Biological Origin | Vaccinia virus (strain Copenhagen) (VACV) |
Expression Region | 1-110aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | A27L14 kDa fusion protein |
Note | For research use only |
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L.
Greater than 90% as determined by SDS-PAGE. | |
28.6 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
14.5 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
19.6 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
19.9 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
14.4 kDa | |
Mammalian cell |