You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Virus A27L protein
Catalog Number: orb595052
| Catalog Number | orb595052 |
|---|---|
| Category | Proteins |
| Description | Recombinant Vaccinia virus 14 kDa fusion protein(A27L) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Protein Length | Full Length |
| UniProt ID | P20535 |
| MW | 16.6 kDa |
| Application notes | Full Length |
| Endotoxins | Not test. |
| Source | Baculovirus |
| Biological Origin | Vaccinia virus (strain Copenhagen) (VACV) |
| Expression Region | 1-110aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | A27L14 kDa fusion protein |
| Note | For research use only |
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L.
- Item 1 of 3
Virus A27L protein [orb605429]
Greater than 90% as determined by SDS-PAGE.
28.6 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Virus A27L protein [orb605439]
Greater than 85% as determined by SDS-PAGE.
14.5 kDa
Yeast
1 mg, 100 μg, 20 μg - Item 1 of 1
Virus A27L protein [orb604609]
Greater than 85% as determined by SDS-PAGE.
19.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Vaccinia virus 14 kDa fusion protein (A27L) [orb1785185]
Greater than 85% as determined by SDS-PAGE.
19.9 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
Recombinant Cowpox virus 14 kDa protein (A27L) [orb1881874]
Greater than 95% as determined by SDS-PAGE.
14.4 kDa
Mammalian cell
1 mg, 20 μg, 100 μg
