You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Influenza A virus (strain A/USA:Iowa/1943 H1N1) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 1-252aa |
| Protein Length | Full Length |
| MW | 32.8 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Viral M2 protein [orb54153]
Greater than 90% as determined by SDS-PAGE.
6.5 kDa
E.coli
1 mg, 100 μg, 20 μgViral M2 protein [orb54676]
Greater than 90% as determined by SDS-PAGE.
15.1 kDa
in vitro E.coli expression system
100 μg, 20 μgViral Matrix protein [orb419349]
Greater than 85% as determined by SDS-PAGE.
28.1 kDa
E.coli
1 mg, 100 μg, 20 μgIntegrin alpha V Rabbit mAb [KD Validated] Antibody [orb1951048]
ICC, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Monoclonal
Unconjugated
100 μl, 50 μl[KO] Integrin alpha V Rabbit mAb [orb1565483]
IHC-P, KO/KD Validated, WB
Human, Mouse, Rat
Monoclonal
Unconjugated
100 μl, 20 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/USA: Iowa/1943 H1N1) M.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/USA: Iowa/1943 H1N1) M.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Viral Matrix protein 1 protein (orb419328)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


![Integrin alpha V Rabbit mAb [KD Validated] Antibody](/images/pub/media/catalog/product/NewWebsite/18/orb1951048_1.png)
![Integrin alpha V Rabbit mAb [KD Validated] Antibody](/images/pub/media/catalog/product/NewWebsite/18/orb1951048_2.png)
![[KO] Integrin alpha V Rabbit mAb](/images/pub/media/catalog/product/NewWebsite/21/orb1565483_1.jpg)
![[KO] Integrin alpha V Rabbit mAb](/images/pub/media/catalog/product/NewWebsite/21/orb1565483_2.jpg)