You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324709 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Tgif2lx1 |
Target | Tgif2lx1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
Protein Sequence | Synthetic peptide located within the following region: RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE |
UniProt ID | Q8K5B9 |
MW | 27kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti MGC130458 antibody, anti Tex1 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_694749 |
WB Suggested Anti-Tgifx1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Muscle.