Cart summary

You have no items in your shopping cart.

TGIFX1 Rabbit Polyclonal Antibody (Biotin)

TGIFX1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2130401

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2130401
CategoryAntibodies
DescriptionTGIFX1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityMouse
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of mouse TGIFX1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW25kDa
UniProt IDQ2NKH6
Protein SequenceSynthetic peptide located within the following region: HSNPSEEVKAQFNENADMQDLPLPIRQDSEEKVPYLESSPNQKVIAEDNI
NCBINP_694749
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesTex1, Tgif2, Tgifx, Tgifx1, Tgif2lx
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.