Cart summary

You have no items in your shopping cart.

Tgifx1 Rabbit Polyclonal Antibody (FITC)

Tgifx1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2130400

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2130400
CategoryAntibodies
DescriptionTgifx1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityMouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Protein SequenceSynthetic peptide located within the following region: RYKPYSLSHEGQAANAAQKQHSNPSEEVKTQFNENADMQDLPLPIRQDSE
UniProt IDQ8K5B9
MW27kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesTex1, Tgif2, Tgifx, Tgifx1, Tgif2lx
NoteFor research use only
NCBINP_694749