Tfam Rabbit Polyclonal Antibody

• Catalog Number: orb576169
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Tfam
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse Tfam
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29 kDa
• Target: Tfam
• UniProt ID: P40630
• Protein Sequence: Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE
• NCBI: NP_033386
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: mouse Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Mouse testicle

WB Suggested Anti-Tfam Antibody Titration: 0.2-1 ug/ml, Positive Control: SP2/0 cell lysate.