You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576169 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Tfam |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse Tfam |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29 kDa |
Target | Tfam |
UniProt ID | P40630 |
Protein Sequence | Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE |
NCBI | NP_033386 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
Sample Tissue: mouse Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.
Mouse testicle
WB Suggested Anti-Tfam Antibody Titration: 0.2-1 ug/ml, Positive Control: SP2/0 cell lysate.
FC, IF, IHC-P, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Bovine, Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |