TFAM Rabbit Polyclonal Antibody

• Catalog Number: orb573781
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TFAM
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: TFAM
• UniProt ID: Q00059
• Protein Sequence: Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS
• NCBI: NP_003192
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1 and 2: HepG2 cell lysate, Lane 3 and 4: Hep3B cell lysate, Lane 5 and 6: K562 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Secondary Antibody dilution: 1:1000, Gene Name: TFAM.

TFAM antibody - N-terminal region (orb573781) validated by WB using bEND3 cell lysate at Lane 1:10 ug, Lane 2:20 ug.

TFAM antibody - N-terminal region (orb573781) validated by WB using bEND3 cell lysate at Lane 1:10 ug, Lane 2:20 ug.

WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.