You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb573781 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TFAM |
| Target | TFAM |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TFAM |
| Protein Sequence | Synthetic peptide located within the following region: AKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPS |
| UniProt ID | Q00059 |
| MW | 29kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TCF6, MTTF1, MTTFA, TCF6L1, TCF6L2, TCF6L3, MTDPS1 Read more... |
| Research Area | Cardiovascular Research, Epigenetics & Chromatin, Read more... |
| Note | For research use only |
| NCBI | NP_003192 |

Lanes: Lane 1 and 2: HepG2 cell lysate, Lane 3 and 4: Hep3B cell lysate, Lane 5 and 6: K562 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Secondary Antibody dilution: 1:1000, Gene Name: TFAM.

TFAM antibody - N-terminal region (orb573781) validated by WB using bEND3 cell lysate at Lane 1:10 ug, Lane 2:20 ug.

TFAM antibody - N-terminal region (orb573781) validated by WB using bEND3 cell lysate at Lane 1:10 ug, Lane 2:20 ug.

WB Suggested Anti-TFAM Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
ELISA, IF, IHC-P, WB | |
Bovine, Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review