Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TCTN3 Rabbit Polyclonal Antibody

SKU: orb579244

Description

TCTN3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TCTN3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human TCTN3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TCTN3
TargetTCTN3
Protein SequenceSynthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
Molecular Weight64kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

OFD4, TECT3, JBTS18, C10orf61

Similar Products

  • TCTN3 Rabbit Polyclonal Antibody [orb631790]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • TCTN3 Rabbit Polyclonal Antibody [orb158585]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Human, Mouse, Rabbit, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • TCTN3 Rabbit Polyclonal Antibody (HRP) [orb478924]

    ELISA,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • TCTN3 Rabbit Polyclonal Antibody (Cy3) [orb986997]

    ICC,  IF

    Bovine, Canine, Gallus, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    Cy3

    100 μl
  • TCTN3 Rabbit Polyclonal Antibody (PE-Cy5.5) [orb921362]

    ICC,  IF

    Bovine, Canine, Gallus, Human, Mouse, Rabbit, Rat, Sheep

    Rabbit

    Polyclonal

    PE/Cy5.5

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TCTN3 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

TCTN3 Rabbit Polyclonal Antibody

Rabbit Anti-TCTN3 Antibody, Catalog Number: orb579244, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Plasma membrane and cytoplasm in hepatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

TCTN3 Rabbit Polyclonal Antibody

WB Suggested Anti-TCTN3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate. TCTN3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_056446

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

TCTN3 Rabbit Polyclonal Antibody (orb579244)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry