TAZ Rabbit Polyclonal Antibody

• Catalog Number: orb331226
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAZ
• Target: TAZ
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of TAZ
• Protein Sequence: Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ
• UniProt ID: Q16635
• MW: 28kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BTHS antibody, anti CMD3A antibody, anti EFE
• Research Area: Cardiovascular Research
• Note: For research use only
• NCBI: NP_851828

Lanes: Lane 1: 20 ug mouse cardiac mitochondria lysate, Lane 2: 20 ug mouse cardiac mitochondria lysate, Lane 3: 20 ug mouse cardiac mitochondria lysate, Lane 4: 20 ug mouse cardiac mitochondria lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: TAZ An.

WB Suggested Anti-TAZ Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.