You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb331226 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TAZ |
| Target | TAZ |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of TAZ |
| Protein Sequence | Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ |
| UniProt ID | Q16635 |
| MW | 28kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti BTHS antibody, anti CMD3A antibody, anti EFE Read more... |
| Research Area | Cardiovascular Research |
| Note | For research use only |
| NCBI | NP_851828 |

Lanes: Lane 1: 20 ug mouse cardiac mitochondria lysate, Lane 2: 20 ug mouse cardiac mitochondria lysate, Lane 3: 20 ug mouse cardiac mitochondria lysate, Lane 4: 20 ug mouse cardiac mitochondria lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: TAZ An.

WB Suggested Anti-TAZ Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.
WB | |
Bovine, Canine, Guinea pig, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Gallus, Human, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review