You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592961 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TAL1 |
Target | TAL1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TAL1 |
Protein Sequence | Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL |
UniProt ID | P17542 |
MW | 34kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SCL, TCL5, tal-1, bHLHa17 |
Note | For research use only |
NCBI | NP_003180 |
Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
Human Spleen
WB Suggested Anti-TAL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |