TAL1 Rabbit Polyclonal Antibody

• Catalog Number: orb592842
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAL1
• Target: TAL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TAL1
• Protein Sequence: Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
• UniProt ID: P17542
• MW: 34kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SCL, TCL5, tal-1, bHLHa17
• Note: For research use only
• NCBI: NP_003180

Human Breast

Human Breast

Human Liver

Rabbit Anti-TAL1 Antibody, Paraffin Embedded Tissue: Human hepatocyte cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-TAL1 Antibody Titration: 0.6 ug/ml, Positive Control: Fetal Muscle cell lysate.