TAC1 Rabbit Polyclonal Antibody

• Catalog Number: orb333728
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Substance P
• Target: TAC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAC1
• Protein Sequence: Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
• UniProt ID: P20366
• MW: 13kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C-terminal-flanking peptide antibody, anti Ne
• Note: For research use only
• NCBI: NP_054703

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-TAC1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.