Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TAC1 Rabbit Polyclonal Antibody

SKU: orb333728

Description

Rabbit polyclonal antibody to Substance P

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TAC1
TargetTAC1
Protein SequenceSynthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
Molecular Weight13kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C-terminal-flanking peptide antibody, anti Neurokinin 1 antibody, anti Neurokinin 2 antibody, anti Neurokinin A antibody, anti Neurokinin alpha antibody, anti Neuromedin L antibody, anti Neuropeptide gamma antibody, anti Neuropeptide K antibody, anti NKA antibody, anti NKNA antibody, anti NPK antibody, anti PPT antibody, anti Protachykinin 1 precursor antibody, anti Substance K antibody, anti SubstanceP antibody, anti TAC1 antibody, anti TAC2 antibody, anti Tachykinin 1 antibody, anti Tachykinin 2 antibody, anti Tachykinin precursor 1 antibody, anti Tachykinin1 antibody

Similar Products

  • Substance P Rabbit Polyclonal Antibody [orb13610]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 500 μg
  • Substance P Rabbit Polyclonal Antibody [orb308740]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Substance P Rabbit Polyclonal Antibody [orb500982]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Neurokinin A Rabbit Polyclonal Antibody [orb500956]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Substance P Rabbit Polyclonal Antibody (FITC) [orb360804]

    ICC,  IF

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TAC1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

TAC1 Rabbit Polyclonal Antibody

WB Suggested Anti-TAC1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_054703

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

TAC1 Rabbit Polyclonal Antibody (orb333728)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry