TAAR1 Rabbit Polyclonal Antibody

• Catalog Number: orb588985
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TAAR1
• Target: TAAR1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAAR1
• Protein Sequence: Synthetic peptide located within the following region: NDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVD
• UniProt ID: Q96RJ0
• MW: 39 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TA1, TAR1, TRAR1
• Research Area: Epigenetics, GPCR, Neuroscience, Signaling Pathway
• Note: For research use only
• NCBI: NP_612200.1

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.