SYNJ1 Rabbit Polyclonal Antibody

• Catalog Number: orb577964
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SYNJ1
• Target: SYNJ1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SYNJ1
• Protein Sequence: Synthetic peptide located within the following region: PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
• UniProt ID: O43426
• MW: 173 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DEE53, EIEE53, INPP5G, PARK20
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_003886

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide sequence contained in 173 kDa, 145 kDa, 143 kDa isoforms. A small isoform of 33 kDa also contains this peptide sequence.

WB Suggested Anti-SYNJ1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Stomach.