SYMPK Rabbit Polyclonal Antibody

SKU: orb325043

Description

Rabbit polyclonal antibody to SYMPK

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYMPK
• Target: SYMPK
• Protein Sequence: Synthetic peptide located within the following region: RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW
• Molecular Weight: 141kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ27092 antibody, anti SPK antibody, anti SYM antibody

Sample Type: Human HT29 cells, Primary Antibody Dilution: 1:50, Secondary Antibody: Donkey anti Rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: Symplekin Blue: DAPI, Gene Name: SYMPK.

WB Suggested Anti-SYMPK Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

SYMPK

UniProt

Q92797

RefSeq (Protein):NP_004810