ST3GAL6 Rabbit Polyclonal Antibody

• Catalog Number: orb589578
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ST3GAL6
• Target: ST3GAL6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST3GAL6
• Protein Sequence: Synthetic peptide located within the following region: SYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILT
• UniProt ID: Q9Y274
• MW: 36 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SIAT10, ST3GALVI
• Research Area: Cell Biology, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_001258074.1

Sample Tissue: Human Lung Tumor lysates, Antibody Dilution: 1 ug/ml.