SPP1 Rabbit Polyclonal Antibody

• Catalog Number: orb576067
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Osteopontin
• Target: SPP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Goat, Guinea pig, Mouse, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPP1
• Protein Sequence: Synthetic peptide located within the following region: DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS
• UniProt ID: P10451
• MW: 33kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OPN, BNSP, BSPI, ETA-1
• Note: For research use only
• NCBI: NP_000573

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Human kidney

WB Suggested Anti-SPP1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.