You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576067 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Osteopontin |
Target | SPP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Goat, Guinea pig, Mouse, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPP1 |
Protein Sequence | Synthetic peptide located within the following region: DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS |
UniProt ID | P10451 |
MW | 33kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | OPN, BNSP, BSPI, ETA-1 |
Note | For research use only |
NCBI | NP_000573 |
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 5 ug/ml.
Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.
Human kidney
WB Suggested Anti-SPP1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
FC, IF, IHC-Fr, IHC-P, WB | |
Human | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Rat | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Human, Rat | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |