SOX2 Rabbit Polyclonal Antibody

• Catalog Number: orb573909
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX2
• Target: SOX2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Frog, Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
• Protein Sequence: Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV
• UniProt ID: P48431
• MW: 34kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ANOP3, MCOPS3
• Research Area: Cancer Biology, Epigenetics & Chromatin, Stem Cell
• Note: For research use only
• NCBI: NP_003097

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Human kidney

Human Spleen

Application:IHC Species+tissue/cell type: Xenopus laevis cornea epithellium Primary antibody dilution: 1:300 Secondary antibody:Goat anti-rabbit -rhodamine Secondary antibody dilution: 1:300.

Sample Type: Lane 1: 20 ug U87 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2000.

WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:500, Positive Control: OVCAR-3 cell lysate, There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3.