You have no items in your shopping cart.
SNCB Antibody
SKU: orb1463340
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Dilution Range | WB:1:500-1:5,000 |
| Reactivity | Canine, Human, Monkey, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Goat |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli. Antigen Sequence: SRETGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA |
| Target | Synuclein Beta |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Form/Appearance | Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum. |
| Concentration | 2 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Beta-Synuclein, Synuclein Beta antibody.
Similar Products
−Synuclein-β rabbit pAb Antibody [orb766416]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlAlpha + beta Synuclein Rabbit Polyclonal Antibody [orb155635]
FC, ICC
Bovine, Canine, Gallus, Porcine, Rabbit
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Synuclein Beta
Documents Download
Datasheet
Product Information
Request a Document
SNCB Antibody (orb1463340)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review












