SNCB Antibody

SKU: orb1463340

Description

Goat polyclonal antibody to SNCB. Beta-Synuclein is a member of Synuclein family which includes alpha and gamma. SNCB inhibits phospholipase D2 and may function in neuronal plasticity. It is a non-amyloid component of senile plaques found in Alzheimer disease and can act as a regulator of SNCA aggregation process.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:500-1:5,000
• Reactivity: Canine, Human, Monkey, Mouse, Rat
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli. Antigen Sequence: SRETGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
• Target: Synuclein Beta
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 2 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Beta-Synuclein, Synuclein Beta antibody.

Quick Database Links

Gene Symbol

Synuclein Beta