Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SNCB Antibody

SKU: orb1463340

Description

Goat polyclonal antibody to SNCB. Beta-Synuclein is a member of Synuclein family which includes alpha and gamma. SNCB inhibits phospholipase D2 and may function in neuronal plasticity. It is a non-amyloid component of senile plaques found in Alzheimer disease and can act as a regulator of SNCA aggregation process.

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:5,000
ReactivityCanine, Human, Monkey, Mouse, Rat
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli. Antigen Sequence: SRETGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
TargetSynuclein Beta
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration2 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Beta-Synuclein, Synuclein Beta antibody.

Similar Products

  • Synuclein-β rabbit pAb Antibody [orb766416]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Human Synuclein Beta (SNCb) ELISA Kit [orb782758]

    Human

    15.63-1000 pg/mL

    7.1 pg/mL

    48 T, 96 T
  • Rat Synuclein Beta (SNCb) ELISA Kit [orb782776]

    Rat

    15.63-1000 pg/mL

    6.8 pg/mL

    96 T, 48 T
  • SNCB Antibody [orb685600]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SNCB Antibody (C-term) [orb1930332]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SNCB Antibody (orb1463340)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

200 μg
$ 700.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry