Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SMPDL3B Rabbit Polyclonal Antibody

SKU: orb574860

Description

SMPDL3B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SMPDL3B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B
TargetSMPDL3B
Protein SequenceSynthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
Molecular Weight52 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ASML3B

Similar Products

  • SMPDL3B Rabbit Polyclonal Antibody [orb631344]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • SMPDL3B Rabbit Polyclonal Antibody [orb155295]

    ELISA,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SMPDL3B Rabbit Polyclonal Antibody [orb313163]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Human, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • SMPDL3B Rabbit Polyclonal Antibody (HRP) [orb474075]

    ELISA,  IHC-Fr,  IHC-P

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • SMPDL3B Rabbit Polyclonal Antibody (APC) [orb1001252]

    ICC,  IF

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SMPDL3B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. 52 kDa precursor is processed to 48 kDa and protein is N-link glycosylated.

SMPDL3B Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

SMPDL3B Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

SMPDL3B Rabbit Polyclonal Antibody

Positive control (+): 293T (2T), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

SMPDL3B Rabbit Polyclonal Antibody

Human Intestine

SMPDL3B Rabbit Polyclonal Antibody

WB Suggested Anti-SMPDL3B Antibody Titration: 0.2-1 ug/ml, Positive Control: Raji cell lysate, SMPDL3B is supported by BioGPS gene expression data to be expressed in Raji.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055289

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

SMPDL3B Rabbit Polyclonal Antibody (orb574860)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry