SMPDL3B Rabbit Polyclonal Antibody

• Catalog Number: orb574860
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMPDL3B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 52 kDa
• Target: SMPDL3B
• UniProt ID: Q92485
• Protein Sequence: Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
• NCBI: NP_055289
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ASML3B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. 52 kDa precursor is processed to 48 kDa and protein is N-link glycosylated.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

Human Intestine

WB Suggested Anti-SMPDL3B Antibody Titration: 0.2-1 ug/ml, Positive Control: Raji cell lysate, SMPDL3B is supported by BioGPS gene expression data to be expressed in Raji.