You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb574860 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SMPDL3B |
| Target | SMPDL3B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B |
| Protein Sequence | Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF |
| UniProt ID | Q92485 |
| MW | 52 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ASML3B |
| Research Area | Signal Transduction |
| Note | For research use only |
| NCBI | NP_055289 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. 52 kDa precursor is processed to 48 kDa and protein is N-link glycosylated.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

Human Intestine

WB Suggested Anti-SMPDL3B Antibody Titration: 0.2-1 ug/ml, Positive Control: Raji cell lysate, SMPDL3B is supported by BioGPS gene expression data to be expressed in Raji.
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
ICC, IF | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review