Cart summary

You have no items in your shopping cart.

SMPDL3B Rabbit Polyclonal Antibody (FITC)

SMPDL3B Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2135884

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2135884
CategoryAntibodies
DescriptionSMPDL3B Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B
Protein SequenceSynthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
UniProt IDQ92485
MW52kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesASML3B
NoteFor research use only
NCBINP_055289