Cart summary

You have no items in your shopping cart.

SMPDL3B Rabbit Polyclonal Antibody (Biotin)

SMPDL3B Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2135882

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2135882
CategoryAntibodies
DescriptionSMPDL3B Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMPDL3B
Protein SequenceSynthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
UniProt IDQ92485
MW52kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesASML3B
NoteFor research use only
NCBINP_055289
Images
Similar Products
  • SMPDL3B Rabbit Polyclonal Antibody (Biotin) [orb452236]

    ELISA,  ICC,  IF,  IHC-Fr,  IHC-P

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Reviews

SMPDL3B Rabbit Polyclonal Antibody (Biotin) (orb2135882)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet