SMAD5 Rabbit Polyclonal Antibody

• Catalog Number: orb574012
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMAD5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMAD5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 51kDa
• Target: SMAD5
• UniProt ID: Q99717
• Protein Sequence: Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
• NCBI: NP_005894
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DWFC, JV5-1, MADH5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 5 ug of transfected 293T lysate (SMAD1), Lane 1: 5 ug of transfected 293T lysate (SMAD2), Lane 1: 5 ug of transfected 293T lysate (SMAD3), Lane 1: 5 ug of transfected 293T lysate (SMAD4), Lane 1: 5 ug of transfected 293T lysate (SMAD5), Lane 1: 5 ug of transfected 293T lysate (SMAD6), Lane 1: 5 ug of transfected 293T lysate (SMAD7), Lane 1: 5 ug of transfected 293T lysate (SMAD8), Lane 1: 5 ug of transfected 293T lysate (GFP), Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit IgG HRP Conjugated, Secondary Antibody dilution: 1:10000, Gene Name: SMAD5.

WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.