Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SMAD5 Rabbit Polyclonal Antibody

SKU: orb574012

Description

Rabbit polyclonal antibody to SMAD5

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SMAD5
TargetSMAD5
Protein SequenceSynthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
Molecular Weight51kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DWFC, JV5-1, MADH5

Similar Products

  • Phospho-Smad1/5 (Ser463 + Ser465) Rabbit Polyclonal Antibody [orb6977]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • SMAD5 Rabbit Polyclonal Antibody [orb137918]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SMAD1 + SMAD5 Rabbit Polyclonal Antibody [orb100675]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • SMAD5 Rabbit Polyclonal Antibody [orb313124]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Guinea pig, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • SMAD5 Rabbit Polyclonal Antibody [orb631309]

    ELISA,  FC,  IF,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SMAD5 Rabbit Polyclonal Antibody

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

SMAD5 Rabbit Polyclonal Antibody

Lanes: Lane 1: 5 ug of transfected 293T lysate (SMAD1), Lane 1: 5 ug of transfected 293T lysate (SMAD2), Lane 1: 5 ug of transfected 293T lysate (SMAD3), Lane 1: 5 ug of transfected 293T lysate (SMAD4), Lane 1: 5 ug of transfected 293T lysate (SMAD5), Lane 1: 5 ug of transfected 293T lysate (SMAD6), Lane 1: 5 ug of transfected 293T lysate (SMAD7), Lane 1: 5 ug of transfected 293T lysate (SMAD8), Lane 1: 5 ug of transfected 293T lysate (GFP), Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit IgG HRP Conjugated, Secondary Antibody dilution: 1:10000, Gene Name: SMAD5.

SMAD5 Rabbit Polyclonal Antibody

WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005894

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SMAD5 Rabbit Polyclonal Antibody (orb574012)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry