SMAD5 Rabbit Polyclonal Antibody

SKU: orb574012

Description

Rabbit polyclonal antibody to SMAD5

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMAD5
• Target: SMAD5
• Protein Sequence: Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DWFC, JV5-1, MADH5

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 5 ug of transfected 293T lysate (SMAD1), Lane 1: 5 ug of transfected 293T lysate (SMAD2), Lane 1: 5 ug of transfected 293T lysate (SMAD3), Lane 1: 5 ug of transfected 293T lysate (SMAD4), Lane 1: 5 ug of transfected 293T lysate (SMAD5), Lane 1: 5 ug of transfected 293T lysate (SMAD6), Lane 1: 5 ug of transfected 293T lysate (SMAD7), Lane 1: 5 ug of transfected 293T lysate (SMAD8), Lane 1: 5 ug of transfected 293T lysate (GFP), Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit IgG HRP Conjugated, Secondary Antibody dilution: 1:10000, Gene Name: SMAD5.

WB Suggested Anti-SMAD5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

SMAD5

UniProt

Q99717

RefSeq (Protein):NP_005894