SLC35A2 Rabbit Polyclonal Antibody

• Catalog Number: orb588697
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC35A2
• Target: SLC35A2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC35A2
• Protein Sequence: Synthetic peptide located within the following region: GAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTK
• UniProt ID: A2AER4
• MW: 41 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: UGT, CDGX, UGAT, UGT1, UGT2, UGTL, CDG2M, UGALT, U
• Note: For research use only
• NCBI: NP_001027460.1

Sample Tissue: Mouse Heart lysates, Antibody Dilution: 1.0 ug/ml.