You have no items in your shopping cart.
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Target | Slc25a27 |
| Protein Sequence | Synthetic peptide located within the following region: EDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSA |
| Molecular Weight | 36kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti 3632410G24Rik antibody, anti 9430092A03Rik antibody, anti D530043E16Rik antibody, anti Ucp4 antibody
Similar Products
−Slc25a27 Rabbit Polyclonal Antibody (HRP) [orb2120081]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
HRP
100 μlSlc25a27 Rabbit Polyclonal Antibody (FITC) [orb2120082]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
FITC
100 μlSlc25a27 Rabbit Polyclonal Antibody (Biotin) [orb2120083]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].


