SLC1A3 Rabbit Polyclonal Antibody

• Catalog Number: orb589636
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC1A3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 60 kDa
• Target: SLC1A3
• UniProt ID: P43003
• Protein Sequence: Synthetic peptide located within the following region: TKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFV
• NCBI: NP_001160167.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EA6, EAAT1, GLAST, GLAST1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 60 kDa isoform is identified, a second isoform of 57 kDa, and a third isoform of 55 kDa is also present in some samples.

Sample Tissue: Human Mesenchymoma Tumor lysates, Antibody Dilution: 1 ug/ml.