You have no items in your shopping cart.
SHH Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Gallus, Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SHH |
| Target | SHH |
| Protein Sequence | Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
| Molecular Weight | 28 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Shh Rabbit Polyclonal Antibody [orb11368]
IF, IHC-Fr, IHC-P, WB
Bovine, Equine, Gallus, Human, Rabbit
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlSonic Hedgehog/SHH Rabbit Polyclonal Antibody [orb146711]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgSHH Rabbit Polyclonal Antibody [orb2952753]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μgSHH Antibody [orb1277512]
IHC
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Chicken embryos, Primary antibody: 1:1000 (orb579101) anti-shh Secondary Antibody: 1:500 (ASP00001) goat anti-rabbit HRP conjugated.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-SHH Antibody, Catalog Number: orb579101, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Plasma membrane, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human glioma cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: 1. SHH: Green 2. DAPI: Blue 3. Merge, Gene Name: SHH.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
Protocol Information
SHH Rabbit Polyclonal Antibody (orb579101)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








