SH2D3A Rabbit Polyclonal Antibody

• Catalog Number: orb589114
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SH2D3A
• Target: SH2D3A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH2D3A
• Protein Sequence: Synthetic peptide located within the following region: QVPQDGEDLAGQPWYHGLLSRQKAEALLQQNGDFLVRASGSRGGNPVISC
• UniProt ID: Q9BRG2
• MW: 63 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NSP1
• Research Area: Cell Biology, Signal Transduction, Stem Cell & Dev
• Note: For research use only
• NCBI: NP_005481.2

Sample Tissue: Human 721_B lymphoblast Whole Cell lysates, Antibody Dilution: 1 ug/ml.