SFTPA2 Rabbit Polyclonal Antibody

• Catalog Number: orb331250
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SFTPA1
• Target: SFTPA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SFTPA2
• Protein Sequence: Synthetic peptide located within the following region: KYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYT
• UniProt ID: Q8IWL1
• MW: 20kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PSAP, PSPA, SP-A, SPA2, PSP-A, SFTP1, SP-2A, SPAII
• Note: For research use only
• NCBI: NP_001092138.1

Sample Type: HCT15 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.