You have no items in your shopping cart.
SFTPA2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | SFTPA2 |
| Protein Sequence | Synthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL |
| Molecular Weight | 26kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SFTPA1/2 Rabbit Polyclonal Antibody [orb251573]
IF, IHC, IHC-Fr, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgSP-A rabbit pAb Antibody [orb766796]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlSFTPA1 Rabbit Polyclonal Antibody [orb11402]
IF, IHC-Fr, IHC-P
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlSFTPA1/2 Rabbit Polyclonal Antibody [orb215430]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Lanes: 1: 20 ng human SP-A2 protein, 2: 20 ug rat wt BAL cell lysate, 3: 25 ng hSP-A2 (1A0) protein purified from transfected CHO lysate, 4: 25 ng hSP-A2 (1A1) protein purified from transfected CHO lysate, 5: 25 ng hSP-A1 (6A2) protein purified from transfected CHO lysate, 6: 25 ng hSP-A1 (6A4) protein purified from transfected CHO lysate, 7: 25 ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate, 8: 25 ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate, 9: 20 ug SP-A KO mouse BAL lysate, 10: 25 ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate, 11: 25 ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate, 12: 25 ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate, 13: 25 ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate, 14: 25 ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate, 15: 25 ng mouse SP-A2 protein purified from mouse BAL lysate, 16: 20 ug mouse wt BAL lysate, 17: 15 ug human wt T2 lysate, 18: 25 ng human SP-A2 protein.

Lanes: Lane 1: 25 ng purified Human Alveolar sample (w/SP-A1+SP-A2), Lane 1: 25 ng purified Human Alveolar sample (w/SP-A1+SP-A2), Lane 2: 20 ug Rat bronchoalveolar lavage, Lane 3: 25 ng hSP-A2 variant expressed in CHO cells, Lane 4: 25 ng hSP-A2 variant expressed in CHO cells, Lane 5: 25 ng hSP-A1/A2 variants expressed in CHO cells, Lane 6: 25 ng hSP-A1/A2 variants expressed in CHO cells, Lane 7: 20 ug SP-A1/2 KO mouse bronchoalveolar lavage, Lane 8: 20 ug hSP-A2 variant transgenic mouse bronchoalveolar lavage, Lane 9: 20 ug hSP-A2 variant transgenic mouse bronchoalveolar lavage, Lane 10: 20 ug hSP-A1 variant transgenic mouse bronchoalveolar lavage, Lane 11: 20 ug hSP-A1 variant transgenic mouse bronchoalveolar lavage, Lane 12: 20 ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavage, Lane 13: 20 ug mSP-A1/A2 bronchoalveolar lavage; +/- mouse, Lane 14: 20 ug mSP-A1/A2 bronchoalveolar lavage; WT mouse, Lane 15: 10 ug human alveolar cell lysate, Lane 16: 25 ng purified hSP-A1/A2, Primary Antibody Dilution: 1:2500, Secondary Antibody: IgG HRP Conj, Secondary Antibody Dilution: 1:10000, Gene Name: SFTPA2.

WB Suggested Anti-SFTPA2 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Heart.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001092138 |
|---|
Documents Download
Request a Document
SFTPA2 Rabbit Polyclonal Antibody (orb326486)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review















