SFTPA2 Rabbit Polyclonal Antibody

• Catalog Number: orb326486
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SFTPA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: SFTPA2
• UniProt ID: Q8IWL1
• Protein Sequence: Synthetic peptide located within the following region: PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL
• NCBI: NP_001092138
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti COLEC5 antibody, anti FLJ50594 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1: 20 ng human SP-A2 protein, 2: 20 ug rat wt BAL cell lysate, 3: 25 ng hSP-A2 (1A0) protein purified from transfected CHO lysate, 4: 25 ng hSP-A2 (1A1) protein purified from transfected CHO lysate, 5: 25 ng hSP-A1 (6A2) protein purified from transfected CHO lysate, 6: 25 ng hSP-A1 (6A4) protein purified from transfected CHO lysate, 7: 25 ng hSP-A2/1 (1A0/6A4) protein purified from transfected CHO lysate, 8: 25 ng hSP-A2/1 (1A1/6A2) protein purified from transfected CHO lysate, 9: 20 ug SP-A KO mouse BAL lysate, 10: 25 ng hSP-A2 (1A0) protein purified from transfected mouse BAL lysate, 11: 25 ng hSP-A2 (1A1) protein purified from transfected mouse BAL lysate, 12: 25 ng hSP-A1 (6A2) protein purified from transfected mouse BAL lysate, 13: 25 ng hSP-A1 (6A4) protein purified from transfected mouse BAL lysate, 14: 25 ng hSP-A2/1 (1A0/6A2) protein purified from transfected mouse BAL lysate, 15: 25 ng mouse SP-A2 protein purified from mouse BAL lysate, 16: 20 ug mouse wt BAL lysate, 17: 15 ug human wt T2 lysate, 18: 25 ng human SP-A2 protein.

Lanes: Lane 1: 25 ng purified Human Alveolar sample (w/SP-A1+SP-A2), Lane 1: 25 ng purified Human Alveolar sample (w/SP-A1+SP-A2), Lane 2: 20 ug Rat bronchoalveolar lavage, Lane 3: 25 ng hSP-A2 variant expressed in CHO cells, Lane 4: 25 ng hSP-A2 variant expressed in CHO cells, Lane 5: 25 ng hSP-A1/A2 variants expressed in CHO cells, Lane 6: 25 ng hSP-A1/A2 variants expressed in CHO cells, Lane 7: 20 ug SP-A1/2 KO mouse bronchoalveolar lavage, Lane 8: 20 ug hSP-A2 variant transgenic mouse bronchoalveolar lavage, Lane 9: 20 ug hSP-A2 variant transgenic mouse bronchoalveolar lavage, Lane 10: 20 ug hSP-A1 variant transgenic mouse bronchoalveolar lavage, Lane 11: 20 ug hSP-A1 variant transgenic mouse bronchoalveolar lavage, Lane 12: 20 ug hSP-A1/A2 variants transgenic mouse bronchoalveolar lavage, Lane 13: 20 ug mSP-A1/A2 bronchoalveolar lavage; +/- mouse, Lane 14: 20 ug mSP-A1/A2 bronchoalveolar lavage; WT mouse, Lane 15: 10 ug human alveolar cell lysate, Lane 16: 25 ng purified hSP-A1/A2, Primary Antibody Dilution: 1:2500, Secondary Antibody: IgG HRP Conj, Secondary Antibody Dilution: 1:10000, Gene Name: SFTPA2.

WB Suggested Anti-SFTPA2 Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Heart.