SCN5A antibody

• Catalog Number: orb329799
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SCN5A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCN5A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 227kDa
• Target: SCN5A
• UniProt ID: Q14524
• Protein Sequence: Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
• NCBI: NP_000326
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CDCD2 antibody, anti CMD1E antibody, anti CMP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human heart tissue using SCN5A antibody

Western blot analysis of human Fetal Muscle tissue using SCN5A antibody

Western blot analysis of human Muscle tissue using SCN5A antibody