SCN5A Rabbit Polyclonal Antibody

• Catalog Number: orb329799
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SCN5A
• Target: SCN5A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCN5A
• Protein Sequence: Synthetic peptide located within the following region: SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
• UniProt ID: Q14524
• MW: 227kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CDCD2 antibody, anti CMD1E antibody, anti CMP
• Research Area: Cell Biology, Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: NP_000326

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-SCN5A Antibody, Catalog Number: orb329799, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-SCN5A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Human Muscle.